DPEP1_HUMAN P16444
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P16444
Recommended name：Dipeptidase 1
EC number：EC:3.4.13.19
Alternative names：(Beta-lactamase) (Dehydropeptidase-I) (Microsomal dipeptidase) (Renal dipeptidase) (hRDP)
Cleaved into：
GeneID：1800
Gene names (primary )：DPEP1
Gene names (synonym )：MDP RDP
Gene names (ORF )：
Length：411
Mass：45674
Sequence：MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLASLAPLVLCLSLL
Tissue specificity：Expressed in lung and kidneys. {ECO:0000269|PubMed:31442408, ECO:0000269|PubMed:8439558}.
Induction：Up-regulated in n colorectal cancers. {ECO:0000269|PubMed:28413640}.
Developmental stage：
Protein families：Metallo-dependent hydrolases superfamily, Peptidase M19 family