PSB2_HUMAN P49721
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P49721
Recommended name:Proteasome subunit beta type-2
EC number:EC:3.4.25.1
Alternative names:(Macropain subunit C7-I) (Multicatalytic endopeptidase complex subunit C7-I) (Proteasome component C7-I)
Cleaved into:
GeneID:5690
Gene names (primary ):PSMB2
Gene names (synonym ):
Gene names (ORF ):
Length:201
Mass:22836
Sequence:MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
Tissue specificity:
Induction:Up-regulated in ovarian cancer cell lines. {ECO:0000269|PubMed:19787249}.
Developmental stage:
Protein families:Peptidase T1B family