KCTD5_HUMAN Q9NXV2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NXV2
Recommended name：BTB/POZ domain-containing protein KCTD5
EC number：
Alternative names：
Cleaved into：
GeneID：54442
Gene names (primary )：KCTD5
Gene names (synonym )：
Gene names (ORF )：
Length：234
Mass：26093
Sequence：MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKILQERGSRM
Tissue specificity：
Induction：Up-regulated in peripheral blood lymphocytes stimulated through the T-cell receptor. {ECO:0000269|PubMed:18573101}.
Developmental stage：
Protein families：