GPR31_HUMAN O00270
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O00270
Recommended name:12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor
EC number:
Alternative names:(12-(S)-HETE receptor) (12-HETER) (G-protein coupled receptor 31) (GPR31/12-HETER)
Cleaved into:
GeneID:2853
Gene names (primary ):GPR31
Gene names (synonym ):
Gene names (ORF ):
Length:319
Mass:35075
Sequence:MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALADLLLAACLPFLAAFYLSLQAWHLGRVGCWALHFLLDLSRSVGMAFLAAVALDRYLRVVHPRLKVNLLSPQAALGVSGLVWLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEALSCLQFVLPFGLIVFCNAGIIRALQKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPVVYCFSSPTFRSSYRRVFHTLRGKGQAAEPPDFNPRDSYS
Tissue specificity:
Induction:Up-regulated in prostate cancer. {ECO:0000269|PubMed:26965684}.
Developmental stage:
Protein families:G-protein coupled receptor 1 family