BPIA1_HUMAN Q9NP55
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NP55
Recommended name:BPI fold-containing family A member 1
EC number:
Alternative names:(Lung-specific protein X) (Nasopharyngeal carcinoma-related protein) (Palate lung and nasal epithelium clone protein) (Secretory protein in upper respiratory tracts) (Short PLUNC1) (SPLUNC1) (Tracheal epithelium-enriched protein) (Von Ebner protein Hl)
Cleaved into:
GeneID:51297
Gene names (primary ):BPIFA1
Gene names (synonym ):LUNX NASG PLUNC SPLUNC1 SPURT
Gene names (ORF ):UNQ787/PRO1606
Length:256
Mass:26713
Sequence:MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV
Tissue specificity:Highly expressed in lung, upper airways and nasopharyngeal regions, including trachea and nasal epithelium (at protein level) (PubMed:11018263, PubMed:11251963, PubMed:12409287, PubMed:11425234, PubMed:26559477). Specifically expressed in the secretory ducts and submucosal glands of tracheobronchial tissues (at protein level) (PubMed:12409287, PubMed:11425234). Also expressed in the eye where it is detected in lacrimal gland, eyelid, conjunctiva and cornea (at protein level) (PubMed:26559477). Specifically localizes to epithelial cell layers in cornea, eyelid (basal epithelium) and conjunctiva (at protein level) (PubMed:26559477). Detected within acinar cells and ducts in the lacrimal and Meibomian glands (at protein level) (PubMed:26559477). In lung, shows highest expression in the trachea and progressive decrease from proximal (bronchial) to distal (bronchiolar) airways (PubMed:12409287). Also expressed in lung cancers and some other types of cancer (PubMed:11251963). {ECO:0000269|PubMed:11018263, ECO:0000269|PubMed:11251963, ECO:0000269|PubMed:11425234, ECO:0000269|PubMed:12409287, ECO:0000269|PubMed:26559477}.
Induction:Up-regulated in response to all-trans retinoic acid (ATRA) (PubMed:12409287). Up-regulated in tear fluid of patients suffering from dry eye disease (PubMed:26559477). Up-regulated in response to the proinflammatory cytokines IL1B and TNF, and the bacteria E.coli and P.aeruginosa (PubMed:26559477). {ECO:0000269|PubMed:12409287, ECO:0000269|PubMed:26559477}.
Developmental stage:
Protein families:BPI/LBP/Plunc superfamily, Plunc family