DERL2_HUMAN Q9GZP9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9GZP9
Recommended name：Derlin-2
EC number：
Alternative names：(Degradation in endoplasmic reticulum protein 2) (DERtrin-2) (Der1-like protein 2) (F-LAN-1) (F-LANa)
Cleaved into：
GeneID：51009
Gene names (primary )：DERL2
Gene names (synonym )：DER2 FLANA
Gene names (ORF )：CGI-101 SBBI53
Length：239
Mass：27567
Sequence：MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFLGQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDVFPNQPGGIRILKTPSILKAIFDTPDEDPNYNPLPEERPGGFAWGEGQRLGG
Tissue specificity：Ubiquitous. Overexpressed in various hepatocarcinomas. {ECO:0000269|PubMed:11500051, ECO:0000269|PubMed:16449189}.
Induction：Up-regulated in response to endoplasmic reticulum stress via the ERN1-XBP1 pathway of the unfolded protein response (UPR). {ECO:0000269|PubMed:16449189}.
Developmental stage：
Protein families：Derlin family