COF1_HUMAN P23528
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P23528
Recommended name：Cofilin-1
EC number：
Alternative names：(18 kDa phosphoprotein) (p18) (Cofilin, non-muscle isoform)
Cleaved into：
GeneID：1072
Gene names (primary )：CFL1
Gene names (synonym )：CFL
Gene names (ORF )：
Length：166
Mass：18502
Sequence：MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
Tissue specificity：Widely distributed in various tissues.
Induction：Up-regulated in response to enterovirus 71 (EV71) infection (at protein level). {ECO:0000269|PubMed:16548883}.
Developmental stage：
Protein families：Actin-binding proteins ADF family