BWNIN_HUMAN Q69YU5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q69YU5
Recommended name：Protein BRAWNIN
EC number：
Alternative names：
Cleaved into：
GeneID：728568
Gene names (primary )：BRAWNIN
Gene names (synonym )：BR C12orf73
Gene names (ORF )：
Length：71
Mass：8023
Sequence：MPAGVPMSTYLKMFAASLLAMCAGAEVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEELK
Tissue specificity：Cardiac and skeletal muscle (at protein level). {ECO:0000269|PubMed:32161263}.
Induction：Up-regulated in response to glucose, serum, fatty acid starvation and AMPK activation using 5-aminoimidizole-4-carboxamide-1-beta- D-riboside. {ECO:0000269|PubMed:32161263}.
Developmental stage：
Protein families：