PYDC5_HUMAN   W6CW81


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:W6CW81

Recommended name:Pyrin domain-containing protein 5

EC number:

Alternative names:(Pyrin domain-only protein 3)

Cleaved into:

GeneID:107181291

Gene names  (primary ):PYDC5

Gene names  (synonym ):POP3

Gene names  (ORF ):

Length:113

Mass:12732

Sequence:MESKYKEILLLTSLDNITDEELDRFKCFLPDEFNIATGKLHTLNSTSSQLDLKRWHGVCSEEDRIFQKLNYMLVAKCLREEQETGICGSPSSARSVSQSRLGLSFHGISGNAC

Tissue specificity:Expressed in monocytic cell lines and primary macrophages but not in B or T cells. {ECO:0000269|PubMed:24531343}.

Induction:Up-regulated in response to IFNB1 or virus infection. {ECO:0000269|PubMed:24531343}.

Developmental stage:

Protein families:


   💬 WhatsApp