RNAS7_HUMAN   Q9H1E1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H1E1

Recommended name:Ribonuclease 7

EC number:EC:3.1.27.-

Alternative names:(RNase 7) (Skin-derived antimicrobial protein 2) (SAP-2)

Cleaved into:

GeneID:84659

Gene names  (primary ):RNASE7

Gene names  (synonym ):

Gene names  (ORF ):UNQ2516/PRO6006

Length:156

Mass:17419

Sequence:MAPARAGFCPLLLLLLLGLWVAEIPVSAKPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRVL

Tissue specificity:Expressed in collecting ducts in kidney, and in apical uroepithelium in bladder (at protein level) (PubMed:25075772). Expressed in various epithelial tissues including skin, respiratory tract, genito-urinary tract and, at a low level, in the gut (PubMed:12244054). Expressed in liver, kidney, skeletal muscle and heart (PubMed:12527768). {ECO:0000269|PubMed:12244054, ECO:0000269|PubMed:12527768, ECO:0000269|PubMed:25075772}.

Induction:Up-regulated in response to the cytokines IL1B, IFNG and TNF (PubMed:12244054). Strongly up-regulated in response to the bacterium P.aeruginosa (PubMed:12244054). Moderately up-regulated in response to S.aureus, E.coli and S.pyogenes (PubMed:12244054). Up-regulated in kidney in response to infection (PubMed:25075772). {ECO:0000269|PubMed:12244054, ECO:0000269|PubMed:25075772}.

Developmental stage:

Protein families:Pancreatic ribonuclease family


   💬 WhatsApp