CAR18_HUMAN P57730
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P57730
Recommended name：Caspase recruitment domain-containing protein 18
EC number：
Alternative names：(Caspase-1 inhibitor Iceberg)
Cleaved into：
GeneID：59082
Gene names (primary )：CARD18
Gene names (synonym )：ICEBERG
Gene names (ORF )：UNQ5804/PRO19611
Length：90
Mass：10138
Sequence：MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH
Tissue specificity：Primarily expressed in the heart and placenta. {ECO:0000269|PubMed:11051551}.
Induction：Up-regulated in response to TNF and bacterial lipopolysaccharides (LPS). {ECO:0000269|PubMed:11051551}.
Developmental stage：
Protein families：