KTDAP_HUMAN P60985
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P60985
Recommended name：Keratinocyte differentiation-associated protein
EC number：
Alternative names：
Cleaved into：
GeneID：388533
Gene names (primary )：KRTDAP
Gene names (synonym )：KDAP
Gene names (ORF )：UNQ467/PRO826
Length：99
Mass：11050
Sequence：MKIPVLPAVVLLSLLVLHSAQGATLGGPEEESTIENYASRPEAFNTPFLNIDKLRSAFKADEFLNWHALFESIKRKLPFLNWDAFPKLKGLRSATPDAQ
Tissue specificity：Highly expressed in skin and detected at lower levels in thymus. In skin, found exclusively in lamellar granules of granular keratinocytes and in the intracellular space of the stratum corneum. Also highly expressed in oral mucosa, tongue, esophagus, and stomach, and at much lower levels in bladder and uterus. Not detected in gastrointestinal mucosa. {ECO:0000269|PubMed:15140226}.
Induction：Up-regulated in situ in psoriatic skin (at protein level). {ECO:0000269|PubMed:15140226}.
Developmental stage：
Protein families：