B4GT5_HUMAN O43286
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O43286
Recommended name：Beta-1,4-galactosyltransferase 5
EC number：EC:2.4.1.-
Alternative names：(Beta-1,4-GalTase 5) (Beta4Gal-T5) (b4Gal-T5) (Beta-1,4-GalT II) (Glucosylceramide beta-1,4-galactosyltransferase) (Lactosylceramide synthase) (LacCer synthase) (UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 5) (UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 5)
Cleaved into：
GeneID：9334
Gene names (primary )：B4GALT5
Gene names (synonym )：
Gene names (ORF )：
Length：388
Mass：45119
Sequence：MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMMQAQGILIRDNVRTIGAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMPRWKVAILIPFRNRHEHLPVLFRHLLPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLNYFANITYDALYKNITVNLTPELAQVNEY
Tissue specificity：Ubiquitously expressed. {ECO:0000269|PubMed:9435216}.
Induction：Up-regulated in subcutaneous adipose tissue during obesity and diabetes. {ECO:0000269|PubMed:29415997}.
Developmental stage：
Protein families：Glycosyltransferase 7 family