TM250_HUMAN   H0YL14


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:H0YL14

Recommended name:Transmembrane protein 250

EC number:

Alternative names:(Herpes virus UL25-binding protein)

Cleaved into:

GeneID:90120

Gene names  (primary ):TMEM250

Gene names  (synonym ):C9orf69

Gene names  (ORF ):

Length:139

Mass:16083

Sequence:MPVMPIPRRVRSFHGPHTTCLHAACGPVRASHLARTKYNNFDVYIKTRWLYGFIRFLLYFSCSLFTAALWGALAALFCLQYLGVRVLLRFQRKLSVLLLLLGRRRVDFRLVNELLVYGIHVTMLLVGGLGWCFMVFVDM

Tissue specificity:

Induction:Up-regulated upon HHV-1 infection. {ECO:0000269|PubMed:21667337}.

Developmental stage:

Protein families:


   💬 WhatsApp