D131A_HUMAN P59861
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P59861
Recommended name：Beta-defensin 131A
EC number：
Alternative names：(Beta-defensin 31) (DEFB-31) (Defensin, beta 131)
Cleaved into：
GeneID：644414
Gene names (primary )：DEFB131A
Gene names (synonym )：DEFB131 DEFB31
Gene names (ORF )：
Length：70
Mass：8199
Sequence：MRVLFFVFGVLSLMFTVPPARSFISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKW
Tissue specificity：Highly expressed in testis. Is moderately expressed in the prostate and small intestine. {ECO:0000269|PubMed:12600824}.
Induction：Up-regulated upon stimulation with lipoteichoic acid. {ECO:0000269|PubMed:26649771}.
Developmental stage：
Protein families：Beta-defensin family