SLUR2_HUMAN P0DP57
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0DP57
Recommended name：Secreted Ly-6/uPAR domain-containing protein 2
EC number：
Alternative names：(Secreted LY6/PLAUR domain-containing protein 2) (Secreted Ly-6/uPAR-related protein 2) (SLURP-2)
Cleaved into：
GeneID：432355
Gene names (primary )：SLURP2
Gene names (synonym )：
Gene names (ORF )：
Length：97
Mass：10160
Sequence：MQLGTGLLLAAVLSLQLAAAEAIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD
Tissue specificity：Expressed at highest levels in cervix and esophagus, followed by adult and fetal skin. Expressed at lower levels in brain, lung, stomach, small intestine, colon, rectum, uterus, and thymus. Not detected in spleen nor bone marrow. Up-regulated 3-fold in psoriatic lesional skin (PubMed:12573258). In the epidermis, predominantly produced by keratinocytes of the suprabasal epidermal compartment (at protein level) (PubMed:16575903). In attached gingiva, produced at highest levels by basal cells located in the lowermost epithelial layers (at protein level) (PubMed:16575903). Detected in serum (at protein level) (PubMed:16575903). {ECO:0000269|PubMed:12573258, ECO:0000269|PubMed:16575903}.
Induction：Up-regulation by IL22/interleukin-22 is suppressed by IFNG/Interferon gamma (at protein level). {ECO:0000269|PubMed:26033490}.
Developmental stage：
Protein families：