LEUTX_HUMAN A8MZ59
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A8MZ59
Recommended name：Paired-like homeodomain transcription factor LEUTX
EC number：
Alternative names：(Leucine-twenty homeobox) (Paired-like homeobox transcription factor LEUTX) (PRD-LIKE homeobox transcription factor LEUTX)
Cleaved into：
GeneID：342900
Gene names (primary )：LEUTX
Gene names (synonym )：
Gene names (ORF )：
Length：198
Mass：22358
Sequence：MFEGPRRYRRPRTRFLSKQLTALRELLEKTMHPSLATMGKLASKLQLDLSVVKIWFKNQRAKWKRQQRQQMQTRPSLGPANQTTSVKKEETPSAITTANIRPVSPGISDANDHDLREPSGIKNPGGASASARVSSWDSQSYDIEQICLGASNPPWASTLFEIDEFVKIYDLPGEDDTSSLNQYLFPVCLEYDQLQSSV
Tissue specificity：
Induction：
Developmental stage：[Isoform 1]: During early embryo development, its expression is restricted to the 4-cell to 8-cell stage of the preimplantation embryo. {ECO:0000269|PubMed:27578796}.
Protein families：Paired homeobox family