SPT25_HUMAN   Q9BR10


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BR10

Recommended name:Spermatogenesis-associated protein 25

EC number:

Alternative names:(Testis-specific gene 23 protein)

Cleaved into:

GeneID:128497

Gene names  (primary ):SPATA25

Gene names  (synonym ):C20orf165 TSG23

Gene names  (ORF ):

Length:227

Mass:23834

Sequence:MSYFRTPQTHPGPLPSGQGGAASPGLSLGLCSPVEPVVVASGGTGPLSQKAEQVAPAAQAWGPALAMPQARGCPGGTSWETLRKEYSRNCHKFPHVRQLESLGWDNGYSRSRAPDLGGPSRPRPLMLCGLSPRVLPVPSEAVGKEASSQPDICILTLAMMIAGIPTVPVPGVREEDLIWAAQAFMMAHPEPEGAVEGARWEQAHAHTASGKMPLVRSKRGQPPGSCL

Tissue specificity:Expressed predominantly in testis (at protein level). Expression is lower in patients with obstructive azoospermia than in fertile controls and is not detected in patients with non-obstructive azoospermia. {ECO:0000269|PubMed:19240080}.

Induction:

Developmental stage:60-fold stronger expression found in adult than fetal testis. Detected in spermatocytes and round spermatids of the seminiferous tubule. {ECO:0000269|PubMed:19240080}.

Protein families:SPATA25 family


   💬 WhatsApp