SCF_HUMAN   P21583


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P21583

Recommended name:Kit ligand

EC number:

Alternative names:(Mast cell growth factor) (MGF) (Stem cell factor) (SCF) (c-Kit ligand)

Cleaved into:Soluble KIT ligand (sKITLG)

GeneID:4254

Gene names  (primary ):KITLG

Gene names  (synonym ):MGF SCF

Gene names  (ORF ):

Length:273

Mass:30899

Sequence:MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV

Tissue specificity:

Induction:

Developmental stage:Acts in the early stages of hematopoiesis.

Protein families:SCF family


   💬 WhatsApp