TSPY1_HUMAN Q01534
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q01534
Recommended name：Testis-specific Y-encoded protein 1
EC number：
Alternative names：(Cancer/testis antigen 78) (CT78)
Cleaved into：
GeneID：100289087
Gene names (primary )：TSPY1
Gene names (synonym )：TSPY
Gene names (ORF )：
Length：308
Mass：35012
Sequence：MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESAPEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVGEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS
Tissue specificity：Specifically expressed in testicular tissues. Isoform 1 and isoform 2 are expressed in spermatogonia and spermatocytes. Found in early testicular carcinoma in situ, spermatogonial cells in testicular tissues of 46,X,Y female and in prostate cancer cell lines. {ECO:0000269|PubMed:10747295, ECO:0000269|PubMed:8923009}.
Induction：Up-regulated by androgen in a prostate cancer cell line. {ECO:0000269|PubMed:10747295}.
Developmental stage：Detected in 22-week old testis. {ECO:0000269|PubMed:8923009}.
Protein families：Nucleosome assembly protein (NAP) family