CXL17_HUMAN Q6UXB2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6UXB2
Recommended name：C-X-C motif chemokine 17
EC number：
Alternative names：(6-Cys CXCL17) (Dendritic cell and monocyte chemokine-like protein) (DMC) (VEGF coregulated chemokine 1)
Cleaved into：4-Cys CXCL17
GeneID：284340
Gene names (primary )：CXCL17
Gene names (synonym )：VCC1
Gene names (ORF )：UNQ473/PRO842
Length：119
Mass：13819
Sequence：MKVLISSLLLLLPLMLMSMVSSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL
Tissue specificity：Detected in trachea, stomach, lung and skeletal muscle. Detected in intestine and in normal and asthmatic lung (at protein level). Breast tumors showed 3- to 24-fold up-regulation. {ECO:0000269|PubMed:16455961, ECO:0000269|PubMed:16989774}.
Induction：Found to be up-regulated in duodenal mucosa during acute cholera. {ECO:0000269|PubMed:17307946}.
Developmental stage：Detected in fetal lung.
Protein families：Intercrine alpha (chemokine CxC) family