RPC7_HUMAN O15318
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O15318
Recommended name：DNA-directed RNA polymerase III subunit RPC7
EC number：
Alternative names：(RNA polymerase III subunit C7) (DNA-directed RNA polymerase III subunit G) (RNA polymerase III 32 kDa apha subunit) (RPC32-alpha) (RNA polymerase III 32 kDa subunit) (RPC32)
Cleaved into：
GeneID：10622
Gene names (primary )：POLR3G
Gene names (synonym )：
Gene names (ORF )：
Length：223
Mass：25914
Sequence：MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLALKQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTNTEDVLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDDDAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY
Tissue specificity：Barely detectable in differentiated tissues. Expressed in embryonic stem cells and in other dividing cells, such as some tumor cell lines. {ECO:0000269|PubMed:20154270, ECO:0000269|PubMed:24107381, ECO:0000269|PubMed:28494942}.
Induction：Induced by NANOG and POU5F1/OCT4 (PubMed:21898682). Negatively regulated by the interaction of microRNA MIR1305 with 3 miRNA responsive elements (miREs) in its 3'-UTR (PubMed:27339422). {ECO:0000269|PubMed:21898682, ECO:0000269|PubMed:27339422}.
Developmental stage：Down-regulated in embryonic stem cells upon differentiation into embroid bodies (at protein level) (PubMed:20154270, PubMed:21898682, PubMed:28494942). An analogous down-regulation is observed during differentiation of induced pluripotent stem cells (PubMed:21898682). {ECO:0000269|PubMed:20154270, ECO:0000269|PubMed:21898682, ECO:0000269|PubMed:28494942}.
Protein families：Eukaryotic RPC7 RNA polymerase subunit family