NT2NC_HUMAN P0DPK4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0DPK4
Recommended name：Notch homolog 2 N-terminal-like protein C
EC number：
Alternative names：
Cleaved into：
GeneID：388677
Gene names (primary )：NOTCH2NLC
Gene names (synonym )：
Gene names (ORF )：
Length：236
Mass：25835
Sequence：MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN
Tissue specificity：Expressed in radial glia neural stem cells during cortical development. {ECO:0000269|PubMed:29856954}.
Induction：
Developmental stage：Expressed at very low level during corticogenesis. {ECO:0000269|PubMed:29856955}.
Protein families：NOTCH family