IL23A_HUMAN   Q9NPF7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NPF7

Recommended name:Interleukin-23 subunit alpha

EC number:

Alternative names:(IL-23 subunit alpha) (IL-23-A) (Interleukin-23 subunit p19) (IL-23p19)

Cleaved into:

GeneID:51561

Gene names  (primary ):IL23A

Gene names  (synonym ):SGRF

Gene names  (ORF ):UNQ2498/PRO5798

Length:189

Mass:20730

Sequence:MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Tissue specificity:Secreted by activated dendritic and phagocytic cells and keratinocytes. Also expressed by dermal Langerhans cells (at protein level). {ECO:0000269|PubMed:11114383, ECO:0000269|PubMed:16424222}.

Induction:Up-regulated by a wide array of pathogens and pathogen-products together with self-signals for danger or injury. Up-regulated in psoriatic dermal tissues, in dendritic cells of multiple sclerosis patients and in tumors. {ECO:0000269|PubMed:12421946, ECO:0000269|PubMed:15114670, ECO:0000269|PubMed:15486065, ECO:0000269|PubMed:15731058, ECO:0000269|PubMed:16424222, ECO:0000269|PubMed:16688182, ECO:0000269|PubMed:16751425}.

Developmental stage:Expressed by newborns dendritic cells. {ECO:0000269|PubMed:16342235}.

Protein families:IL-6 superfamily


   💬 WhatsApp