SPR2B_HUMAN P35325
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35325
Recommended name：Small proline-rich protein 2B
EC number：
Alternative names：(SPR-2B)
Cleaved into：
GeneID：6701
Gene names (primary )：SPRR2B
Gene names (synonym )：
Gene names (ORF )：
Length：72
Mass：7975
Sequence：MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK
Tissue specificity：Suprabasal layers of squamous-differentiated tissues such as epidermis, esophagus, tongue and trachea.
Induction：By UV irradiation and carcinogenic agents. During squamous differentiation of epidermal keratinocytes.
Developmental stage：Expressed during differentiation of squamous cells.
Protein families：Cornifin (SPRR) family