GLNA_HUMAN P15104
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P15104
Recommended name：Glutamine synthetase
EC number：EC:6.3.1.2
Alternative names：(GS) (Glutamate--ammonia ligase) (Palmitoyltransferase GLUL)
Cleaved into：
GeneID：2752
Gene names (primary )：GLUL
Gene names (synonym )：GLNS
Gene names (ORF )：
Length：373
Mass：42064
Sequence：MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
Tissue specificity：Expressed in endothelial cells. {ECO:0000269|PubMed:30158707}.
Induction：By glucocorticoids. Vitamin D and the Wnt signaling pathway inhibit its expression and activity. {ECO:0000269|PubMed:18555765}.
Developmental stage：Expressed during early fetal stages. {ECO:0000269|PubMed:18662667}.
Protein families：Glutamine synthetase family