ARTN_HUMAN Q5T4W7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5T4W7
Recommended name：Artemin
EC number：
Alternative names：(Enovin) (Neublastin)
Cleaved into：
GeneID：9048
Gene names (primary )：ARTN
Gene names (synonym )：EVN
Gene names (ORF )：
Length：220
Mass：22878
Sequence：MELGLGGLSTLSHCPWPRQQPALWPTLAALALLSSVAEASLGSAPRSPAPREGPPPVLASPAGHLPGGRTARWCSGRARRPPPQPSRPAPPPPAPPSALPRGGRAARAGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
Tissue specificity：Ubiquitous. Expressed at high levels in peripheral tissues including prostate, placenta, pancreas, heart, kidney, pituitary gland, lung and testis. Expressed at low levels in the brain. {ECO:0000269|PubMed:10583383, ECO:0000269|PubMed:9883723}.
Induction：
Developmental stage：Expressed during embryogenesis. High level expression seen in fetal kidney and lung while a low level expression seen in the fetal brain. {ECO:0000269|PubMed:9883723}.
Protein families：TGF-beta family, GDNF subfamily