MCHL1_HUMAN   Q16048


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q16048

Recommended name:Putative pro-MCH-like protein 1

EC number:

Alternative names:(Pro-MCH variant) (Pro-melanin-concentrating hormone-like protein 1)

Cleaved into:

GeneID:

Gene names  (primary ):PMCHL1

Gene names  (synonym ):

Gene names  (ORF ):

Length:86

Mass:9715

Sequence:MLSQKPKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTQEKRETGDEENSAKFPVGRRDFDTLSCMLGRVYQSCWQV

Tissue specificity:Expressed in testis and brain. {ECO:0000269|PubMed:11070051, ECO:0000269|PubMed:9729295}.

Induction:

Developmental stage:Expressed in developing brain, found in fetal newborn and adult brain. {ECO:0000269|PubMed:11070051}.

Protein families:Melanin-concentrating hormone family


   💬 WhatsApp