ZN322_HUMAN Q6U7Q0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6U7Q0
Recommended name：Zinc finger protein 322
EC number：
Alternative names：(Zinc finger protein 322A) (Zinc finger protein 388) (Zinc finger protein 489)
Cleaved into：
GeneID：79692
Gene names (primary )：ZNF322
Gene names (synonym )：ZNF322A ZNF388 ZNF489
Gene names (ORF )：
Length：402
Mass：46941
Sequence：MYTSEEKCNQRTQKRKIYNVCPRKGKKIFIHMHEIIQIDGHIYQCLECKQNFCENLALIMCERTHTGEKPYKCDMCEKTFVQSSDLTSHQRIHNYEKPYKCSKCEKSFWHHLALSGHQRTHAGKKFYTCDICGKNFGQSSDLLVHQRSHTGEKPYLCSECDKCFSRSTNLIRHRRTHTGEKPFKCLECEKAFSGKSDLISHQRTHTGERPYKCNKCEKSYRHRSAFIVHKRVHTGEKPYKCGACEKCFGQKSDLIVHQRVHTGEKPYKCLECMRSFTRSANLIRHQATHTHTFKCLEYEKSFNCSSDLIVHQRIHMEEKPHQWSACESGFLLGMDFVAQQKMRTQTEELHYKYTVCDKSFHQSSALLQHQTVHIGEKPFVCNVSEKGLELSPPHASEASQMS
Tissue specificity：Ubiquitous. Highly expressed in heart and skeletal muscle. {ECO:0000269|PubMed:15555580}.
Induction：
Developmental stage：Expressed in embryo as early as the 11th week of gestation. {ECO:0000269|PubMed:15555580}.
Protein families：Krueppel C2H2-type zinc-finger protein family