CGBP1_HUMAN Q9UFW8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UFW8
Recommended name：CGG triplet repeat-binding protein 1
EC number：
Alternative names：(CGG-binding protein 1) (20 kDa CGG-binding protein) (p20-CGGBP DNA-binding protein)
Cleaved into：
GeneID：8545
Gene names (primary )：CGGBP1
Gene names (synonym )：CGGBP
Gene names (ORF )：
Length：167
Mass：18820
Sequence：MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC
Tissue specificity：Ubiquitous. Highly expressed in placenta, thymus, lymph nodes, cerebellum and cerebral cortex. Low expression in other regions of the brain. {ECO:0000269|PubMed:14667814}.
Induction：
Developmental stage：Expressed in fetal brain and kidney. Lower expression in fetal liver and lung. {ECO:0000269|PubMed:14667814}.
Protein families：