TP4A1_HUMAN Q93096
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q93096
Recommended name：Protein tyrosine phosphatase type IVA 1
EC number：EC:3.1.3.48
Alternative names：(PTP(CAAXI)) (Protein-tyrosine phosphatase 4a1) (Protein-tyrosine phosphatase of regenerating liver 1) (PRL-1)
Cleaved into：
GeneID：7803
Gene names (primary )：PTP4A1
Gene names (synonym )：PRL1 PTPCAAX1
Gene names (ORF )：
Length：173
Mass：19815
Sequence：MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
Tissue specificity：Expressed in bone marrow, lymph nodes, T lymphocytes, spleen, thymus and tonsil. Overexpressed in tumor cell lines. {ECO:0000269|PubMed:10940933, ECO:0000269|PubMed:12235145}.
Induction：Strongly down-regulated upon tetrodotoxin treatment. {ECO:0000269|PubMed:15501285}.
Developmental stage：Expressed in fetal liver. {ECO:0000269|PubMed:10940933}.
Protein families：Protein-tyrosine phosphatase family