LBH_HUMAN   Q53QV2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q53QV2

Recommended name:Protein LBH

EC number:

Alternative names:(hLBH) (Limb bud and heart development protein homolog)

Cleaved into:

GeneID:81606

Gene names  (primary ):LBH

Gene names  (synonym ):

Gene names  (ORF ):

Length:105

Mass:12217

Sequence:MSIYFPIHCPDYLRSAKMTEVMMNTQPMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETAKENKEQ

Tissue specificity:Highly expressed in heart, and expressed at low levels in placenta, lung, skeletal muscle, kidney and liver. {ECO:0000269|PubMed:17390236}.

Induction:

Developmental stage:Expressed in heart of 25 and 17 weeks embryos. {ECO:0000269|PubMed:17390236}.

Protein families:LBH family


   💬 WhatsApp