NDUAD_HUMAN Q9P0J0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9P0J0
Recommended name：NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
EC number：
Alternative names：(Cell death regulatory protein GRIM-19) (Complex I-B16.6) (CI-B16.6) (Gene associated with retinoic and interferon-induced mortality 19 protein) (GRIM-19) (Gene associated with retinoic and IFN-induced mortality 19 protein) (NADH-ubiquinone oxidoreductase B16.6 subunit)
Cleaved into：
GeneID：51079
Gene names (primary )：NDUFA13
Gene names (synonym )：GRIM19
Gene names (ORF )：CDA016 CGI-39
Length：144
Mass：16698
Sequence：MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
Tissue specificity：Widely expressed, with highest expression in heart, skeletal muscle, liver, kidney and placenta. In intestinal mucosa, down-regulated in areas involved in Crohn disease and ulcerative colitis. {ECO:0000269|PubMed:10924506}.
Induction：By IFNB1/IFN-beta combined with all-trans-retinoic acid (ATRA).
Developmental stage：Expressed in numerous fetal tissues.
Protein families：Complex I NDUFA13 subunit family