MAL_HUMAN   P21145


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P21145

Recommended name:Myelin and lymphocyte protein

EC number:

Alternative names:(T-lymphocyte maturation-associated protein)

Cleaved into:

GeneID:4118

Gene names  (primary ):MAL

Gene names  (synonym ):

Gene names  (ORF ):

Length:153

Mass:16714

Sequence:MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS

Tissue specificity:

Induction:

Developmental stage:Expressed in the intermediate and late stages of T-cell differentiation.

Protein families:MAL family


   💬 WhatsApp