CGB7_HUMAN   P0DN87


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0DN87

Recommended name:Choriogonadotropin subunit beta 7

EC number:

Alternative names:

Cleaved into:

GeneID:94027

Gene names  (primary ):CGB7

Gene names  (synonym ):

Gene names  (ORF ):

Length:165

Mass:17757

Sequence:MEMFQGLLLLLLLSMGGTWASREMLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ

Tissue specificity:High expression in the placenta throughout pregnancy. {ECO:0000269|PubMed:16123088}.

Induction:

Developmental stage:Expressed in the placenta throughout pregnancy. {ECO:0000269|PubMed:16123088}.

Protein families:Glycoprotein hormones subunit beta family


   💬 WhatsApp