VASH2_HUMAN   Q86V25


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q86V25

Recommended name:Tubulinyl-Tyr carboxypeptidase 2

EC number:EC:3.4.17.17

Alternative names:(Vasohibin-2) (Vasohibin-like protein)

Cleaved into:

GeneID:79805

Gene names  (primary ):VASH2

Gene names  (synonym ):VASHL

Gene names  (ORF ):

Length:355

Mass:40450

Sequence:MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHVAKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLQYNHTGTQFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPRRLGRREKSPALPEKKVADLSTLNEVGYQIRI

Tissue specificity:

Induction:By VEGF. {ECO:0000269|PubMed:16528006}.

Developmental stage:Expressed in various embryonic organs at 6 to 12 embryonic weeks. Detected in vessels from 20-week embryonic organs as well as in endothelial cells from large vessels in neonate. {ECO:0000269|PubMed:16528006}.

Protein families:Transglutaminase-like superfamily, Vasohibin family


   💬 WhatsApp