HXB8_HUMAN P17481
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P17481
Recommended name:Homeobox protein Hox-B8
EC number:
Alternative names:(Homeobox protein Hox-2.4) (Homeobox protein Hox-2D)
Cleaved into:
GeneID:3218
Gene names (primary ):HOXB8
Gene names (synonym ):HOX2D
Gene names (ORF ):
Length:243
Mass:27574
Sequence:MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKQKLERAPEAADEGDAQKGDKK
Tissue specificity:
Induction:
Developmental stage:Expressed in whole embryos and fetuses at 5-9 weeks from conception.
Protein families:Antp homeobox family