EID1_HUMAN Q9Y6B2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y6B2
Recommended name：EP300-interacting inhibitor of differentiation 1
EC number：
Alternative names：(21 kDa pRb-associated protein) (CREBBP/EP300 inhibitory protein 1) (E1A-like inhibitor of differentiation 1) (EID-1)
Cleaved into：
GeneID：23741
Gene names (primary )：EID1
Gene names (synonym )：C15orf3 CRI1 RBP21
Gene names (ORF )：PNAS-22 PTD014
Length：187
Mass：20876
Sequence：MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE
Tissue specificity：Widely expressed. Most abundantly expressed in heart, skeletal muscle, pancreas, brain and testis. Expressed at much lower levels in placenta and peripheral blood leukocyte. Barely detectable in lung. Also weakly expressed in lung carcinoma A-549 and various leukemia cell lines. {ECO:0000269|PubMed:11073990, ECO:0000269|PubMed:11223246}.
Induction：Down-regulated in differentiating U-937 leukemia cells. {ECO:0000269|PubMed:11073989}.
Developmental stage：Expression decreased with development in ventricular tissue while remaining highly expressed in adult atrial tissue. In primary cultures of human skeletal myocytes, expression decreased during myogenic differentiation (at protein level). {ECO:0000269|PubMed:11073990}.
Protein families：