OSTN_HUMAN P61366
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61366
Recommended name：Osteocrin
EC number：
Alternative names：(Musclin)
Cleaved into：Processed Osteocrin
GeneID：344901
Gene names (primary )：OSTN
Gene names (synonym )：
Gene names (ORF )：
Length：133
Mass：14722
Sequence：MLDWRLASAHFILAVTLTLWSSGKVLSVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG
Tissue specificity：Enriched in neocortical regions of the developing cerebral cortex (PubMed:27830782). Not expressed in other compartments of the neocortical wall or in brain regions such as the hippocampus, striatum, mediodorsal nucleus of the thalamus and cerebellum (PubMed:27830782). Also expressed in bone (PubMed:14523025). In developing neonatal rib bone, present at high level in osteoblasts on bone-forming surfaces, in newly incorporated osteocytes and in some late hypertrophic chondrocytes (at protein level) (PubMed:15923362). In adult bone, localizes specifically to osteoblasts and young osteocytes at bone-forming sites (at protein level) (PubMed:15923362). {ECO:0000269|PubMed:14523025, ECO:0000269|PubMed:15923362, ECO:0000269|PubMed:27830782}.
Induction：Expression is induced in the developing cerebral cortex in response to neuronal activity in neurons: expression is driven by the presence of a enhancer sequence only present in primates that binds the MEF2 transcription factors (PubMed:27830782). {ECO:0000269|PubMed:27830782}.
Developmental stage：Expression in the developing cerebral cortex increases during the course of fetal development and peaks around the late-mid fetal stage, concurrent with the onset of synaptogenesis in the cortical plate (PubMed:27830782). {ECO:0000269|PubMed:27830782}.
Protein families：Osteocrin family