ROMO1_HUMAN P60602
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P60602
Recommended name：Reactive oxygen species modulator 1
EC number：
Alternative names：(ROS modulator 1) (Epididymis tissue protein Li 175) (Glyrichin) (Mitochondrial targeting GxxxG motif protein) (MTGM) (Protein MGR2 homolog)
Cleaved into：
GeneID：140823
Gene names (primary )：ROMO1
Gene names (synonym )：C20orf52
Gene names (ORF )：
Length：79
Mass：8183
Sequence：MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC
Tissue specificity：Up-regulated in a number of cancer cell lines when compared to a normal lung fibroblast cell line. Highly expressed in brain tumors. {ECO:0000269|PubMed:16842742, ECO:0000269|PubMed:19535734}.
Induction：By the anticancer drug fluorouracil (5FU). {ECO:0000269|PubMed:17537404}.
Developmental stage：Expression increases in senescent cells. {ECO:0000269|PubMed:18836179}.
Protein families：MGR2 family