BTG3_HUMAN Q14201
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q14201
Recommended name：Protein BTG3
EC number：
Alternative names：(Abundant in neuroepithelium area protein) (BTG family member 3) (Protein Tob5)
Cleaved into：
GeneID：10950
Gene names (primary )：BTG3
Gene names (synonym )：ANA TOB5
Gene names (ORF )：
Length：252
Mass：29116
Sequence：MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTLILQEKYKNHWYPEKPSKGQAYRCIRVNKFQRVDPDVLKACENSCILYSDLGLPKELTLWVDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMYRGNGHQNHYPPPVPFGYPNQGRKNKPYRPIPVTWVPPPGMHCDRNHWINPHMLAPH
Tissue specificity：Ubiquitous. High expression in the ventricular zone of the developing central nervous system. High in ovary, testis, prostate, thymus and lung. {ECO:0000269|PubMed:9067576}.
Induction：
Developmental stage：Expression is cell cycle dependent with the highest levels at the end of G1 phase, peaking at the G1-S transition. {ECO:0000269|PubMed:9067576}.
Protein families：BTG family