PO4F1_HUMAN Q01851
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q01851
Recommended name：POU domain, class 4, transcription factor 1
EC number：
Alternative names：(Brain-specific homeobox/POU domain protein 3A) (Brain-3A) (Brn-3A) (Homeobox/POU domain protein RDC-1) (Oct-T1)
Cleaved into：
GeneID：5457
Gene names (primary )：POU4F1
Gene names (synonym )：BRN3A RDC1
Gene names (ORF )：
Length：419
Mass：42697
Sequence：MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHSLGHLSHPAAAAAMNMPSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY
Tissue specificity：Expressed in the brain and the retina. Present in the developing brain, spinal cord and eye. {ECO:0000269|PubMed:1357630, ECO:0000269|PubMed:7623109}.
Induction：
Developmental stage：Expression peaks early in embryogenesis (day 13.5) and is undetectable 14 days after birth. {ECO:0000269|PubMed:1357630}.
Protein families：POU transcription factor family, Class-4 subfamily