CENPA_HUMAN   P49450


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P49450

Recommended name:Histone H3-like centromeric protein A

EC number:

Alternative names:(Centromere autoantigen A) (Centromere protein A) (CENP-A)

Cleaved into:

GeneID:1058

Gene names  (primary ):CENPA

Gene names  (synonym ):

Gene names  (ORF ):

Length:140

Mass:15991

Sequence:MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

Tissue specificity:

Induction:

Developmental stage:Expression varies across the cell cycle, with high levels in G2 phase (at the mRNA level). {ECO:0000269|PubMed:24522885}.

Protein families:Histone H3 family


   💬 WhatsApp