GNAT1_HUMAN P11488
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P11488
Recommended name：Guanine nucleotide-binding protein G
EC number：
Alternative names：(t) subunit alpha-1(Transducin alpha-1 chain)
Cleaved into：
GeneID：2779
Gene names (primary )：GNAT1
Gene names (synonym )：GNATR
Gene names (ORF )：
Length：350
Mass：40041
Sequence：MGAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFERASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFATTSIVLFLNKKDVFFEKIKKAHLSICFPDYDGPNTYEDAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
Tissue specificity：Rod photoreceptor cells (PubMed:1614872). Predominantly expressed in the retina followed by the ciliary body, iris and retinal pigment epithelium (PubMed:22190596). {ECO:0000269|PubMed:1614872, ECO:0000269|PubMed:22190596}.
Induction：
Developmental stage：First detected at low levels at approximately postnatal day 7. Subsequently, expression increases rapidly during the first month after birth. {ECO:0000269|PubMed:22190596}.
Protein families：G-alpha family, G(i/o/t/z) subfamily