SPP24_HUMAN Q13103
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q13103
Recommended name：Secreted phosphoprotein 24
EC number：
Alternative names：(Spp-24) (Secreted phosphoprotein 2)
Cleaved into：
GeneID：6694
Gene names (primary )：SPP2
Gene names (synonym )：SPP24
Gene names (ORF )：
Length：211
Mass：24338
Sequence：MISRMEKMTMMMKILIMFALGMNYWSCSGFPVYDYDPSSLRDALSASVVKVNSQSLSPYLFRAFRSSLKRVEVLDENNLVMNLEFSIRETTCRKDSGEDPATCAFQRDYYVSTAVCRSTVKVSAQQVQGVHARCSWSSSTSESYSSEEMIFGDMLGSHKWRNNYLFGLISDESISEQFYDRSLGIMRRVLPPGNRRYPNHRHRARINTDFE
Tissue specificity：Detected in liver and plasma. {ECO:0000269|PubMed:15062857}.
Induction：
Developmental stage：Found in fetal liver and kidney. {ECO:0000269|PubMed:15062857}.
Protein families：SPP2 family