ITLN1_HUMAN Q8WWA0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8WWA0
Recommended name：Intelectin-1
EC number：
Alternative names：(ITLN-1) (Endothelial lectin HL-1) (Galactofuranose-binding lectin) (Intestinal lactoferrin receptor) (Omentin)
Cleaved into：
GeneID：55600
Gene names (primary )：ITLN1
Gene names (synonym )：INTL ITLN LFR
Gene names (ORF )：UNQ640/PRO1270
Length：313
Mass：34962
Sequence：MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR
Tissue specificity：Highly expressed in omental adipose tissue where it is found in stromal vascular cells but not in fat cells but is barely detectable in subcutaneous adipose tissue (at protein level) (PubMed:16531507). Highly expressed in the small intestine. Also found in the heart, testis, colon, salivary gland, skeletal muscle, pancreas and thyroid and, to a lesser degree, in the uterus, spleen, prostate, lymph node and thymus. {ECO:0000269|PubMed:11181563, ECO:0000269|PubMed:11313366, ECO:0000269|PubMed:11747454, ECO:0000269|PubMed:16531507}.
Induction：
Developmental stage：Found in fetal small intestine and thymus.
Protein families：