TYB10_HUMAN P63313
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63313
Recommended name：Thymosin beta-10
EC number：
Alternative names：
Cleaved into：
GeneID：9168
Gene names (primary )：TMSB10
Gene names (synonym )：PTMB10 THYB10
Gene names (ORF )：
Length：44
Mass：5026
Sequence：MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
Tissue specificity：
Induction：
Developmental stage：Found to decrease dramatically after birth. {ECO:0000269|PubMed:2169566}.
Protein families：Thymosin beta family