MSPD1_HUMAN   Q9UJG1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UJG1

Recommended name:Motile sperm domain-containing protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:56180

Gene names  (primary ):MOSPD1

Gene names  (synonym ):

Gene names  (ORF ):

Length:213

Mass:24086

Sequence:MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRLKEHLTESLFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDVESLVPLYLHLSVNQKLVAAYILGLITMAILRT

Tissue specificity:

Induction:

Developmental stage:Has low expression in pericytes and adventitial vascular cells (ASC) derived from adipose tissue. Highly expressed in differentiating mesenchymal stem cells derived from pericytes and ASC. {ECO:0000269|PubMed:26175344}.

Protein families:


   💬 WhatsApp