REG1A_HUMAN P05451
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P05451
Recommended name：Lithostathine-1-alpha
EC number：
Alternative names：(Islet cells regeneration factor) (ICRF) (Islet of Langerhans regenerating protein) (REG) (Pancreatic stone protein) (PSP) (Pancreatic thread protein) (PTP) (Regenerating islet-derived protein 1-alpha) (REG-1-alpha) (Regenerating protein I alpha)
Cleaved into：
GeneID：5967
Gene names (primary )：REG1A
Gene names (synonym )：PSPS PSPS1 REG
Gene names (ORF )：
Length：166
Mass：18731
Sequence：MAQTSSYFMLISCLMFLSQSQGQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN
Tissue specificity：In pancreatic acinar cells and, in lower levels, in brain. Enhanced expression of PSP-related transcripts and intraneuronal accumulation of PSP-like proteins is found in brain from Alzheimer disease and Down syndrome patients. {ECO:0000269|PubMed:2394826}.
Induction：
Developmental stage：High expression levels in fetal and infant brains; much lower in adult brains. {ECO:0000269|PubMed:2394826}.
Protein families：