HPGDS_HUMAN O60760
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O60760
Recommended name：Hematopoietic prostaglandin D synthase
EC number：EC:5.3.99.2
Alternative names：(H-PGDS) (GST class-sigma) (Glutathione S-transferase) (Glutathione-dependent PGD synthase) (Glutathione-requiring prostaglandin D synthase) (Prostaglandin-H2 D-isomerase)
Cleaved into：
GeneID：27306
Gene names (primary )：HPGDS
Gene names (synonym )：GSTS PGDS PTGDS2
Gene names (ORF )：
Length：199
Mass：23344
Sequence：MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Tissue specificity：Expressed in a number of megakaryocytic cell lines but not in platelets. Highly expressed in adipose tissue, macrophages and placenta. Also expressed at lower levels in lung, heart, lymph nodes, appendix, bone marrow and fetal liver. {ECO:0000269|PubMed:10824118, ECO:0000269|PubMed:11672424, ECO:0000269|PubMed:9353279, ECO:0000269|PubMed:9425264}.
Induction：By 12-O-tetradecanoylphorbol-13-acetate (TPA). {ECO:0000269|PubMed:9425264}.
Developmental stage：Highest levels in immature megakaryocytic cells. Disappears after final differentiation to platelets. {ECO:0000269|PubMed:9425264}.
Protein families：GST superfamily, Sigma family